Brief introduction of three long peptide synthesis techniques

In the study of protein chemical synthesis, solid phase synthesis is the most common and simplest method of synthesis. This method is equally effective in the synthesis of long-chain polypeptides, but as the peptide chain lengthens, the reaction becomes progressively more difficult (eg, greater than 150 amino acids), and some of the residue-deficient target peptides are produced. These residue-deficient peptide chains are also the major impurities produced during the synthesis of long peptides. Therefore, the main difficulty we need to overcome in the synthesis of long peptides is to explore better reaction conditions and reaction methods, so that the amino acid condensation reaction is carried out more fully and thoroughly. At the same time, the reaction time is shortened because the longer the reaction time, the more uncontrollable side reactions are, and the more complicated the by-products are, and these by-products are also an important component of the impurities generated by the entire reaction.
In order to solve many problems in the synthesis of long peptides, our national peptide organisms have adopted a series of significant measures and methods:
(1) Microwave synthesis: For some amino acids that are difficult to condense during the synthesis, we use microwave method to synthesize. This method has remarkable effect and greatly shortens the reaction time and reduces the production of two main by-products.
(2) Fragment synthesis method: When some peptides are difficult to synthesize by conventional synthesis methods, and it is difficult to purify, we also condense a certain amino acid of a certain segment of the polypeptide and condense it as a whole onto the peptide chain. The method can also solve the problems in many synthesis.
(3) Hydrazide synthesis method: A method for synthesizing a polypeptide by a hydrazide method is a method in which a solid phase synthesis of an N-terminal Cys polypeptide and a C-terminal polypeptide hydrazide are chemically selective to form an amide bond to effect polypeptide linkage. According to the position of Cys in the peptide chain, the whole peptide chain is synthesized into a plurality of sequences, and finally the target peptide is obtained through liquid phase condensation reaction, which not only greatly shortens the synthesis time of the long peptide, but also significantly improves the finality. The purity of the product is therefore widely applicable to the synthesis of long-chain polypeptides containing Cys.
Guopeptide has always been committed to solving customer needs. The three long peptide synthesis methods we developed have solved the problems of condensation purification, impurities and low purity in the synthesis of long peptides, and they contain difficult sequences. The peptides with abnormal peaks of HPLC have the same effect, and the national peptide organism has mastered the mature long peptide synthesis technology.
success case:
Our successful synthesis sequence is
GHMDIKKEIEAIKKEQEAIKKKIEAIEKELRQLANETTQDLQLFLRDTTELRTFSILNRKDIDFLLQRMKQIEDKIEEIESKQKKIENEIARIKKLIGERY contains 101 AA long peptides.
HPLC analysis:
MS analysis:

Bake Small Snack Foods

Bake Small Snack Foods,Moon Cake Square Crispy Shell,Crisp Cones With Chocolate Or Cake,Crispy Biscuit And Wafer Biscuit

Tianjin Yongkang Food Co., Ltd , https://www.yongkangfood.com